Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF367 Rabbit Polyclonal Antibody (HRP)

ZNF367 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AFF29, ZFF29, CDC14B

UniProt

Q7RTV3

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF367

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GCLSRFTHANRHCPKHPYARLKREEPTDTLSKHQAADNKAAAEWLARYWE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_710162

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMMECR1-IT1 Protein Vector (Human) (pPM-N-D-C-His)
PV321577 500 ng

AMMECR1-IT1 Protein Vector (Human) (pPM-N-D-C-His)

Sign In for Pricing
View Details
YARS Antibody, Biotin conjugated
CSB-PA00465D0Rb-01 50 µg

YARS Antibody, Biotin conjugated

Sign In for Pricing
View Details
YARS Antibody, Biotin conjugated
CSB-PA00465D0Rb-02 100 µg

YARS Antibody, Biotin conjugated

Sign In for Pricing
View Details
Gm3609 3'UTR GFP Stable Cell Line
TU157975 1.0 mL

Gm3609 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to 17-Hydroxyprogesterone (17-OHP)
MBS2141125-01 0.1 mL

HRP-Linked Monoclonal Antibody to 17-Hydroxyprogesterone (17-OHP)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to 17-Hydroxyprogesterone (17-OHP)
MBS2141125-02 0.2 mL

HRP-Linked Monoclonal Antibody to 17-Hydroxyprogesterone (17-OHP)

Sign In for Pricing
View Details