Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prd Rabbit Polyclonal Antibody (HRP)

Prd Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CG6716, Dmel\CG6716, pr, Prd, PRD

UniProt

P06601

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Fruit fly

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MTVTAFAAAMHRPFFNGYSTMQDMNSGQGRVNQLGGVFINGRPLPNNIRL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_723721

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Anti-Paragonimus antibody,IgM ELISA KIT
JOT-EKD0400Hu 96 wells

Human Anti-Paragonimus antibody,IgM ELISA KIT

Sign In for Pricing
View Details
TRMU, ID (TRMU, MTU1, TRMT1, Mitochondrial tRNA-specific 2-thiouridylase 1, MTO2 homolog) (PE)
MBS6358758-01 0.2 mL

TRMU, ID (TRMU, MTU1, TRMT1, Mitochondrial tRNA-specific 2-thiouridylase 1, MTO2 homolog) (PE)

Sign In for Pricing
View Details
TRMU, ID (TRMU, MTU1, TRMT1, Mitochondrial tRNA-specific 2-thiouridylase 1, MTO2 homolog) (PE)
MBS6358758-02 5x 0.2 mL

TRMU, ID (TRMU, MTU1, TRMT1, Mitochondrial tRNA-specific 2-thiouridylase 1, MTO2 homolog) (PE)

Sign In for Pricing
View Details
BACH2 Rabbit Polyclonal Antibody
orb1881004-01 30 µL

BACH2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BACH2 Rabbit Polyclonal Antibody
orb1881004-02 50 µL

BACH2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BACH2 Rabbit Polyclonal Antibody
orb1881004-03 100 µL

BACH2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details