Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ART5 Rabbit Polyclonal Antibody (FITC)

ART5 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ARTC5

UniProt

Q96L15

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ART5

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VFPKEREVLIPPHEVFLVTRFSQDGAQSLVTLWSYNQTCSHFNCAYLGGE

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_443750

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MORC3 (MORC Family CW-Type Zinc Finger Protein 3, Zinc Finger CW-Type coiled-coil Domain Protein 3, MORC3, KIAA0136, ZCWCC3)
302565 200 µL

MORC3 (MORC Family CW-Type Zinc Finger Protein 3, Zinc Finger CW-Type coiled-coil Domain Protein 3, MORC3, KIAA0136, ZCWCC3)

Sign In for Pricing
View Details
Carbonic Anhydrase 8 Blocking Peptide
MBS8225901-01 1 mg

Carbonic Anhydrase 8 Blocking Peptide

Sign In for Pricing
View Details
Carbonic Anhydrase 8 Blocking Peptide
MBS8225901-02 5 mg

Carbonic Anhydrase 8 Blocking Peptide

Sign In for Pricing
View Details
Carbonic Anhydrase 8 Blocking Peptide
MBS8225901-03 5x 5 mg

Carbonic Anhydrase 8 Blocking Peptide

Sign In for Pricing
View Details
PRKG1 (Protein Kinase, cGMP-Dependent, Type I, CGKI, DKFZp686K042, FLJ36117, MGC71944, PGK, PKG, PRKG1B, PRKGR1B, cGKI-BETA, cGKI-alpha) (FITC)
250497-FITC 100 µL

PRKG1 (Protein Kinase, cGMP-Dependent, Type I, CGKI, DKFZp686K042, FLJ36117, MGC71944, PGK, PKG, PRKG1B, PRKGR1B, cGKI-BETA, cGKI-alpha) (FITC)

Sign In for Pricing
View Details
Mouse GAD1 protein
orb1463687-01 50 µg

Mouse GAD1 protein

Sign In for Pricing
View Details