Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C2orf33 Rabbit Polyclonal Antibody (FITC)

C2orf33 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

EMPF2, GL004, C2orf33

UniProt

Q9GZY8

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human C2orf33

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VVDAASLRRQIIKLNRRLQLLEEENKERAKREMVMYSITVAFWLLNSWLW

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_064579

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Synapsin I/SYN1 Antibody Picoband® (Dylight488 Conjugate)
PB10099-Dylight488 100 µg

Anti-Synapsin I/SYN1 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
Monoclonal Antibody to Leukocyte Associated Immunogloulin Like Receptor 1 (LAIR1)
MBS2152219-01 0.1 mL

Monoclonal Antibody to Leukocyte Associated Immunogloulin Like Receptor 1 (LAIR1)

Sign In for Pricing
View Details
Monoclonal Antibody to Leukocyte Associated Immunogloulin Like Receptor 1 (LAIR1)
MBS2152219-02 0.2 mL

Monoclonal Antibody to Leukocyte Associated Immunogloulin Like Receptor 1 (LAIR1)

Sign In for Pricing
View Details
Monoclonal Antibody to Leukocyte Associated Immunogloulin Like Receptor 1 (LAIR1)
MBS2152219-03 0.5 mL

Monoclonal Antibody to Leukocyte Associated Immunogloulin Like Receptor 1 (LAIR1)

Sign In for Pricing
View Details
Monoclonal Antibody to Leukocyte Associated Immunogloulin Like Receptor 1 (LAIR1)
MBS2152219-04 1 mL

Monoclonal Antibody to Leukocyte Associated Immunogloulin Like Receptor 1 (LAIR1)

Sign In for Pricing
View Details
Monoclonal Antibody to Leukocyte Associated Immunogloulin Like Receptor 1 (LAIR1)
MBS2152219-05 5 mL

Monoclonal Antibody to Leukocyte Associated Immunogloulin Like Receptor 1 (LAIR1)

Sign In for Pricing
View Details