Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIAA1324 Rabbit Polyclonal Antibody (FITC)

KIAA1324 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

EIG121, KIAA1324

UniProt

Q6UXG2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KIAA1324

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PCAEGRYSLGTGIRFDEWDELPHGFASLSANMELDDSAAESTGNCTSSKW

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

111kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_065826

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2103R), 0.2mg/mL
BNUB2103-100 1x 100 µL

Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2103R), 0.2mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: rectosigmoid
CS649098 5x 5 µm

Frozen Tissue Sections, Colon: rectosigmoid

Sign In for Pricing
View Details
Cytokeratin 18 Recombinant Mouse monoclonal Antibody
HA610135 100 µg

Cytokeratin 18 Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
Indigo Carmine 5,7'-Isomer (~90%)
TRC-I521175-5MG 5 mg

Indigo Carmine 5,7'-Isomer (~90%)

Sign In for Pricing
View Details
Colloidal Gold Conjugated Goat Affinity Purified Antibody to Human IgG,  10nm
GAF-001-10 1 mL

Colloidal Gold Conjugated Goat Affinity Purified Antibody to Human IgG, 10nm

Sign In for Pricing
View Details
(11b)-11,17a-Dihydroxy-D-homoandrosta-1,4-diene-3,17-dione
TRC-D452853-25MG 25 mg

(11b)-11,17a-Dihydroxy-D-homoandrosta-1,4-diene-3,17-dione

Sign In for Pricing
View Details