Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tm2d3 Rabbit Polyclonal Antibody (HRP)

Tm2d3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Blp2, 1110025I09Rik, 5930422O05Rik

UniProt

Q8BJ83

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TALALSITLGGFGADRFYLGQWREGLGKLFSFGGLGIWTLIDVLLIGVGY

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_081071

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAG-72 / CA72.4 (Tumor-Associated Glycoprotein) (rB72.3), CF647 conjugate, 0.1mg/mL
BNC473177-100 1x 100 µL

TAG-72 / CA72.4 (Tumor-Associated Glycoprotein) (rB72.3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 3 (KRT3) (Corneal Epithelial Marker) (KRT3/2130), CF405S conjugate, 0.1mg/mL
BNC042130-100 1x 100 µL

Cytokeratin 3 (KRT3) (Corneal Epithelial Marker) (KRT3/2130), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HCG-beta (HCGb/54+ HCGb/459), CF488A conjugate, 0.1mg/mL
BNC881224-100 1x 100 µL

HCG-beta (HCGb/54+ HCGb/459), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human Alpha-Fetoprotein/AFP protein (His tag)
PDMH100106-01 20 µg

Recombinant Human Alpha-Fetoprotein/AFP protein (His tag)

Sign In for Pricing
View Details
Recombinant Human Alpha-Fetoprotein/AFP protein (His tag)
PDMH100106-02 100 µg

Recombinant Human Alpha-Fetoprotein/AFP protein (His tag)

Sign In for Pricing
View Details
Recombinant Human Alpha-Fetoprotein/AFP protein (His tag)
PDMH100106-03 500 µg

Recombinant Human Alpha-Fetoprotein/AFP protein (His tag)

Sign In for Pricing
View Details