Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZBTB46 Rabbit Polyclonal Antibody (Biotin)

ZBTB46 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

BZEL, BTBD4, RINZF, ZNF340, dJ583P15.7, dJ583P15.8

UniProt

Q86UZ6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZBTB46

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MNNRKEDMEITSHYRHLLRELNEQRQHGVLCDVCVVVEGKVFKAHKNVLL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_079500

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tas2r136 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
46170064 1.0 µg DNA

Tas2r136 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
SOX10 (Transcription Factor SOX-10, MGC15649) (MaxLight 405)
MBS6192793-01 0.1 mL

SOX10 (Transcription Factor SOX-10, MGC15649) (MaxLight 405)

Sign In for Pricing
View Details
SOX10 (Transcription Factor SOX-10, MGC15649) (MaxLight 405)
MBS6192793-02 5x 0.1 mL

SOX10 (Transcription Factor SOX-10, MGC15649) (MaxLight 405)

Sign In for Pricing
View Details
Spike Protein (C-mFc, SARS-CoV-2)
P518557 100 µg

Spike Protein (C-mFc, SARS-CoV-2)

Sign In for Pricing
View Details
Epsin 1 Rabbit Polyclonal Antibody (BF750)
orb2527922 100 µL

Epsin 1 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
Neural retinal specific leucine zipper/NRL Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-19351R-BF750 100 µL

Neural retinal specific leucine zipper/NRL Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details