Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HCG_1646157 Rabbit Polyclonal Antibody (Biotin)

HCG_1646157 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

LOC440122, hCG_1646157

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human hCG_1646157

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PVPNNLHMAQNACECNKDETLCHQSSLKKQGQTHTEKKHECNQCGKAFKR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

XP_001129759

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin E (G1/S-Phase Cyclin) (CCNE1/2460), CF740 conjugate, 0.1mg/mL
BNC742460-500 1x 500 µL

Cyclin E (G1/S-Phase Cyclin) (CCNE1/2460), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Topoisomerase I, MT (TOP1MT/488), Biotin conjugate, 0.1mg/mL
BNCB0488-100 1x 100 µL

Topoisomerase I, MT (TOP1MT/488), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human SPATS1 activation kit by CRISPRa
GA116615 1 Kit

Human SPATS1 activation kit by CRISPRa

Sign In for Pricing
View Details
BCL10 (MALT-Lymphoma Marker) (151), CF640R conjugate, 0.1mg/mL
BNC401852-500 1x 500 µL

BCL10 (MALT-Lymphoma Marker) (151), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human LRRC69 activation kit by CRISPRa
GA119127 1 Kit

Human LRRC69 activation kit by CRISPRa

Sign In for Pricing
View Details
EDIL3 Human Gene Knockout Kit (CRISPR)
KN205282RB 1 Kit

EDIL3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details