Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GP1BA Rabbit Polyclonal Antibody (Biotin)

GP1BA Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

BSS, GP1B, VWDP, CD42B, GPIbA, BDPLT1, BDPLT3, DBPLT3, GPIbalpha, CD42b-alpha

UniProt

A5CKE2

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human GP1BA

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYS

Field of Research

Cardiovascular Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

68kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_000164

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human EV71-IgG (Enterovirus 71-Immunoglobulin G) ELISA Kit
EH4401 96 Tests

Human EV71-IgG (Enterovirus 71-Immunoglobulin G) ELISA Kit

Sign In for Pricing
View Details
M7GMP, S pack
JBS-NU-1135S 100 µL

M7GMP, S pack

Sign In for Pricing
View Details
Sheep 9-hydroxy-octadecadienoic acid ELISA kit
GTR10383177 96 Well

Sheep 9-hydroxy-octadecadienoic acid ELISA kit

Sign In for Pricing
View Details
BAD, phosphorylated (Y76) (BAD, BBC6, BCL2L8, Bcl2 antagonist of cell death, Bcl-2-binding component 6, Bcl-2-like protein 8, Bcl-XL/Bcl-2-associated death promoter) (FITC) discontinued
032414-FITC 200 µL

BAD, phosphorylated (Y76) (BAD, BBC6, BCL2L8, Bcl2 antagonist of cell death, Bcl-2-binding component 6, Bcl-2-like protein 8, Bcl-XL/Bcl-2-associated death promoter) (FITC) discontinued

Sign In for Pricing
View Details
Btbd35f12 (NM_001099333) Mouse Untagged Clone
MC217103 10 µg

Btbd35f12 (NM_001099333) Mouse Untagged Clone

Sign In for Pricing
View Details
Befovacimab Biosimilar - Research Grade
ICH5381-1mg 1 mg

Befovacimab Biosimilar - Research Grade

Sign In for Pricing
View Details