Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DUSP8 Rabbit Polyclonal Antibody (FITC)

DUSP8 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HB5, HVH8, HVH-5, C11orf81

UniProt

Q13202

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DUSP8

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PAPPTPPATSALQQGLRGLHLSSDRLQDTNRLKRSFSLDIKSAYAPSRRP

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

66kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_004411

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FLVCR2 (Feline Leukemia Virus Subgroup C Receptor-Related Protein 2, Feline Leukemia Virus Subgroup C Cellular Receptor Family Member 2)
481150 100 µL

FLVCR2 (Feline Leukemia Virus Subgroup C Receptor-Related Protein 2, Feline Leukemia Virus Subgroup C Cellular Receptor Family Member 2)

Sign In for Pricing
View Details
Ectonucleoside triphosphate diphosphohydrolase 8
314341 100 µL

Ectonucleoside triphosphate diphosphohydrolase 8

Sign In for Pricing
View Details
HTR2B (5-hydroxytryptamine Receptor 2B, 5-HT2B, 5-HT(2B)) (FITC)
MBS6421802-01 0.1 mL

HTR2B (5-hydroxytryptamine Receptor 2B, 5-HT2B, 5-HT(2B)) (FITC)

Sign In for Pricing
View Details
HTR2B (5-hydroxytryptamine Receptor 2B, 5-HT2B, 5-HT(2B)) (FITC)
MBS6421802-02 5x 0.1 mL

HTR2B (5-hydroxytryptamine Receptor 2B, 5-HT2B, 5-HT(2B)) (FITC)

Sign In for Pricing
View Details
Anti-ADAMTS4 Antibody
CQA9032-01 30 µL

Anti-ADAMTS4 Antibody

Sign In for Pricing
View Details
Anti-ADAMTS4 Antibody
CQA9032-02 50 μL

Anti-ADAMTS4 Antibody

Sign In for Pricing
View Details