Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C22orf25 Rabbit Polyclonal Antibody (HRP)

C22orf25 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MECRCN, C22orf25

UniProt

Q6ICL3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C22orf25

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MCIIFFKFDPRPVSKNAYRLILAANRDEFYSRPSKLADFWGNNNEILSGL

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_690870

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SFI1 CRISPR Activation Plasmid (m2)
sc-429732-ACT-2 20 µg

SFI1 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
GFER, ID (GFER, ALR, HERV1, HPO, FAD-linked sulfhydryl oxidase ALR, Augmenter of liver regeneration, Hepatopoietin) (MaxLight 750)
MBS6301960-01 0.1 mL

GFER, ID (GFER, ALR, HERV1, HPO, FAD-linked sulfhydryl oxidase ALR, Augmenter of liver regeneration, Hepatopoietin) (MaxLight 750)

Sign In for Pricing
View Details
GFER, ID (GFER, ALR, HERV1, HPO, FAD-linked sulfhydryl oxidase ALR, Augmenter of liver regeneration, Hepatopoietin) (MaxLight 750)
MBS6301960-02 5x 0.1 mL

GFER, ID (GFER, ALR, HERV1, HPO, FAD-linked sulfhydryl oxidase ALR, Augmenter of liver regeneration, Hepatopoietin) (MaxLight 750)

Sign In for Pricing
View Details
CDCA8, NT (CDCA8, PESCRG3, Borealin, Dasra-B, Cell division cycle-associated protein 8, Pluripotent embryonic stem cell-related gene 3 protein) (MaxLight 750) discontinued
033615-ML750 100 µL

CDCA8, NT (CDCA8, PESCRG3, Borealin, Dasra-B, Cell division cycle-associated protein 8, Pluripotent embryonic stem cell-related gene 3 protein) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Recombinant HBcAg/HBV Capsid Protein, N-His-SUMO
orb2966582-01 50 µg

Recombinant HBcAg/HBV Capsid Protein, N-His-SUMO

Sign In for Pricing
View Details
Recombinant HBcAg/HBV Capsid Protein, N-His-SUMO
orb2966582-02 100 µg

Recombinant HBcAg/HBV Capsid Protein, N-His-SUMO

Sign In for Pricing
View Details