Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAJC16 Rabbit Polyclonal Antibody (HRP)

DNAJC16 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ERdj8

UniProt

Q9Y2G8

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human DJC16

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KHREWLEYLLEFAQDAAPIPNQYDKHFMERDYTGYVLALNGHKKYFCLFK

Field of Research

Cell Biology

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Saccharomyces cerevisiae Uncharacterized membrane protein YPR071W (YPR071W)
MBS7039934-01 0.02 mg

Recombinant Saccharomyces cerevisiae Uncharacterized membrane protein YPR071W (YPR071W)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Uncharacterized membrane protein YPR071W (YPR071W)
MBS7039934-02 0.1 mg

Recombinant Saccharomyces cerevisiae Uncharacterized membrane protein YPR071W (YPR071W)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Uncharacterized membrane protein YPR071W (YPR071W)
MBS7039934-03 5x 0.1 mg

Recombinant Saccharomyces cerevisiae Uncharacterized membrane protein YPR071W (YPR071W)

Sign In for Pricing
View Details
TFEB, ID (TFEB, BHLHE35, Transcription factor EB, Class E basic helix-loop-helix protein 35) (APC) discontinued
042767-APC 200 µL

TFEB, ID (TFEB, BHLHE35, Transcription factor EB, Class E basic helix-loop-helix protein 35) (APC) discontinued

Sign In for Pricing
View Details
Anti-PKM2 Antibody Picoband®, HRP Conjugate
PA2046-HRP 100 µg/Vial

Anti-PKM2 Antibody Picoband®, HRP Conjugate

Sign In for Pricing
View Details
PHF6 (PHD Finger Protein 6, BFLS, BORJ, CENP-31) (HRP)
MBS6431472-01 0.1 mL

PHF6 (PHD Finger Protein 6, BFLS, BORJ, CENP-31) (HRP)

Sign In for Pricing
View Details