Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REXO5 Rabbit Polyclonal Antibody (HRP)

REXO5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NEF-sp

UniProt

Q96IC2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human LOC81691

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AEGGCCVMDELVKPENKILDYLTSFSGITKKILNPVTTKLKDVQRQLKAL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

85kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_112203

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMD2, NT (PSMD2, TRAP2, 26S proteasome non-ATPase regulatory subunit 2, 26S proteasome regulatory subunit RPN1, 26S proteasome regulatory subunit S2, 26S proteasome subunit p97, Protein 55.11, Tumor necrosis factor type 1 receptor-associated protein 2) (FITC) discontinued
040565-FITC 200 µL

PSMD2, NT (PSMD2, TRAP2, 26S proteasome non-ATPase regulatory subunit 2, 26S proteasome regulatory subunit RPN1, 26S proteasome regulatory subunit S2, 26S proteasome subunit p97, Protein 55.11, Tumor necrosis factor type 1 receptor-associated protein 2) (FITC) discontinued

Sign In for Pricing
View Details
Recombinant Anti-SPINK1 Rabbit mAb
CMA6068-01 30 µL

Recombinant Anti-SPINK1 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-SPINK1 Rabbit mAb
CMA6068-02 50 μL

Recombinant Anti-SPINK1 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-SPINK1 Rabbit mAb
CMA6068-03 100 µL

Recombinant Anti-SPINK1 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-SPINK1 Rabbit mAb
CMA6068-04 200 µL

Recombinant Anti-SPINK1 Rabbit mAb

Sign In for Pricing
View Details
Benzyl (S) -3-{[ (tert-butoxy) carbonyl]amino}piperidine-1-carboxylate
442430-01 25 mg

Benzyl (S) -3-{[ (tert-butoxy) carbonyl]amino}piperidine-1-carboxylate

Sign In for Pricing
View Details