Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APH1B Rabbit Polyclonal Antibody (HRP)

APH1B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PSFL, APH-1B, PRO1328, TAAV688

UniProt

Q8WW43

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human APH1B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IIDNKDGPTQKYLLIFGAFVSVYIQEMFRFAYYKLLKKASEGLKSINPGE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_112591

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal Antibody to Troponin T Type 2, Cardiac (TNNT2)
TRV-0036151-01 20 µL

Polyclonal Antibody to Troponin T Type 2, Cardiac (TNNT2)

Sign In for Pricing
View Details
Polyclonal Antibody to Troponin T Type 2, Cardiac (TNNT2)
TRV-0036151-02 100 µL

Polyclonal Antibody to Troponin T Type 2, Cardiac (TNNT2)

Sign In for Pricing
View Details
Polyclonal Antibody to Troponin T Type 2, Cardiac (TNNT2)
TRV-0036151-03 200 µL

Polyclonal Antibody to Troponin T Type 2, Cardiac (TNNT2)

Sign In for Pricing
View Details
Polyclonal Antibody to Troponin T Type 2, Cardiac (TNNT2)
TRV-0036151-04 1 mL

Polyclonal Antibody to Troponin T Type 2, Cardiac (TNNT2)

Sign In for Pricing
View Details
3- (tert-Butoxycarbonyl) -6-fluoro-1H-pyrazolo[3,4-b]pyridine
sc-256432 50 mg

3- (tert-Butoxycarbonyl) -6-fluoro-1H-pyrazolo[3,4-b]pyridine

Sign In for Pricing
View Details
FDPS Protein Vector (Mouse) (pPM-C-HA)
20418024 500 ng

FDPS Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details