Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APH1B Rabbit Polyclonal Antibody (HRP)

APH1B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PSFL, APH-1B, PRO1328, TAAV688

UniProt

Q564N3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YYGINLASAFIILVLMGTWAFLAAGGSCRSLKLCLLCQDKNFLLYNQRSR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001139118

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Alpha-Fetoprotein (AFP) ELISA Kit
EKN43402 96 Tests

Human Alpha-Fetoprotein (AFP) ELISA Kit

Sign In for Pricing
View Details
PFDN3 (VBP1) Mouse Monoclonal Antibody [Clone ID: UMAB75]
UM500063 100 µL

PFDN3 (VBP1) Mouse Monoclonal Antibody [Clone ID: UMAB75]

Sign In for Pricing
View Details
Mouse Galectin-3 ELISA Kit
YLA1222MO-01 48 Tests

Mouse Galectin-3 ELISA Kit

Sign In for Pricing
View Details
Mouse Galectin-3 ELISA Kit
YLA1222MO-02 96 Tests

Mouse Galectin-3 ELISA Kit

Sign In for Pricing
View Details
3-{4-[ (cyclopropylamino) carbonyl]phenyl}acrylic acid
sc-346171A 1 g

3-{4-[ (cyclopropylamino) carbonyl]phenyl}acrylic acid

Sign In for Pricing
View Details
PDX1, phosphorylated (T11) (PDX1, IPF1, Pancreas/duodenum homeobox protein 1, Glucose-sensitive factor, Insulin promoter factor 1, Insulin upstream factor 1, Islet/duodenum homeobox-1, Somatostatin-transactivating factor 1) (Azide free) (HRP) discontinued
039857-HRP 200 µL

PDX1, phosphorylated (T11) (PDX1, IPF1, Pancreas/duodenum homeobox protein 1, Glucose-sensitive factor, Insulin promoter factor 1, Insulin upstream factor 1, Islet/duodenum homeobox-1, Somatostatin-transactivating factor 1) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details