Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFT122 Rabbit Polyclonal Antibody (Biotin)

IFT122 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CED, SPG, CED1, FAP80, WDR10, WDR10p, WDR140

UniProt

Q9HBG6

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence EGLDFETAKKAFIRVQDLRYLELISSIEERKKRGETNNDLFLADVFSYQG

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EGLDFETAKKAFIRVQDLRYLELISSIEERKKRGETNNDLFLADVFSYQG

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

142 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

NCBI Accession Number

NP_443715

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DPBS, w/o: Ca and Mg, Powder
P04-36050P 50 L

DPBS, w/o: Ca and Mg, Powder

Sign In for Pricing
View Details
TULP2 Peptide - middle region
orb2020317 100 µg

TULP2 Peptide - middle region

Sign In for Pricing
View Details
Anti-COQ10B Polyclonal Antibody
TMAB-04581-01 50 μL

Anti-COQ10B Polyclonal Antibody

Sign In for Pricing
View Details
Anti-COQ10B Polyclonal Antibody
TMAB-04581-02 100 µL

Anti-COQ10B Polyclonal Antibody

Sign In for Pricing
View Details
Anti-COQ10B Polyclonal Antibody
TMAB-04581-03 200 µL

Anti-COQ10B Polyclonal Antibody

Sign In for Pricing
View Details
Dextran T800 (MW 800,000)
HY-112624Q-01 50 mg

Dextran T800 (MW 800,000)

Sign In for Pricing
View Details