Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFT122 Rabbit Polyclonal Antibody (Biotin)

IFT122 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CED, SPG, CED1, FAP80, WDR10, WDR10p, WDR140

UniProt

Q9HBG6

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human IFT122

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QADPAQKDTMLGKFYHFQRLAELYHGYHAIHRHTEDPFSVHRPETLFNIS

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

129kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_443716

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM126B (Transmembrane Protein 126B, HT007) (APC)
138444-APC 100 µL

TMEM126B (Transmembrane Protein 126B, HT007) (APC)

Sign In for Pricing
View Details
RPS15A Peptide
DF9117-BP 1 mg

RPS15A Peptide

Sign In for Pricing
View Details
ARID1B (AT-rich Interactive Domain-containing Protein 1B, ARID Domain-containing Protein 1B, BRG1-associated Factor 250b, BAF250B, BRG1-binding Protein hELD/OSA1, Osa Homolog 2, hOsa2, p250R, BAF250B, DAN15, KIAA1235, OSA2) (MaxLight 750)
MBS6231618-01 0.1 mL

ARID1B (AT-rich Interactive Domain-containing Protein 1B, ARID Domain-containing Protein 1B, BRG1-associated Factor 250b, BAF250B, BRG1-binding Protein hELD/OSA1, Osa Homolog 2, hOsa2, p250R, BAF250B, DAN15, KIAA1235, OSA2) (MaxLight 750)

Sign In for Pricing
View Details
ARID1B (AT-rich Interactive Domain-containing Protein 1B, ARID Domain-containing Protein 1B, BRG1-associated Factor 250b, BAF250B, BRG1-binding Protein hELD/OSA1, Osa Homolog 2, hOsa2, p250R, BAF250B, DAN15, KIAA1235, OSA2) (MaxLight 750)
MBS6231618-02 5x 0.1 mL

ARID1B (AT-rich Interactive Domain-containing Protein 1B, ARID Domain-containing Protein 1B, BRG1-associated Factor 250b, BAF250B, BRG1-binding Protein hELD/OSA1, Osa Homolog 2, hOsa2, p250R, BAF250B, DAN15, KIAA1235, OSA2) (MaxLight 750)

Sign In for Pricing
View Details
Pleated Cartridge, Polypro,1μm, Gen Purpose,20", OD:69mm,226/Fin, Polypro, Silicone, SS reinforced, Rev.0
CFPPP0100G200AG1PSY0 1 Piece/Case:1 Piece/ PACKS:1 PACKS/CASE

Pleated Cartridge, Polypro,1μm, Gen Purpose,20", OD:69mm,226/Fin, Polypro, Silicone, SS reinforced, Rev.0

Sign In for Pricing
View Details
RNASE8, CT (RNASE8, Ribonuclease 8) (MaxLight 750) discontinued
041096-ML750 100 µL

RNASE8, CT (RNASE8, Ribonuclease 8) (MaxLight 750) discontinued

Sign In for Pricing
View Details