PGK2 Rabbit Polyclonal Antibody (Biotin)
PGK2 Rabbit Polyclonal Antibody (Biotin)
Product Specifications
Product Name Alternative
PGKB, PGKPS, HEL-S-272, dJ417L20.2
UniProt
P07205
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human PGK2
Clonality
Polyclonal
Conjugation
Biotin
Sequence
Synthetic peptide located within the following region: ITVIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKILPGVEALSNM
Field of Research
Metabolism Research
Purification
Affinity Purified
Form
Liquid. Purified antibody supplied in 1x PBS buffer.
Molecular Weight
46kDa
Storage Conditions
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Notes
For research use only.
Prediction Reactivity
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Tested Applications
WB
NCBI Accession Number
NP_620061
Host or Source
Rabbit
Preservative
Liquid. Purified antibody supplied in 1x PBS buffer.
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Mouse Monoclonal CNOT10 Antibody (PCRP-CNOT10-1D5) [DyLight 488]](https://cdn.genprice.uk/genprice/uk/genprice5.webp)
NBP3-14266G 0.1 mL
Mouse Monoclonal CNOT10 Antibody (PCRP-CNOT10-1D5) [DyLight 488]
Sign In for Pricing
View Details 414955-01 10 mg
2-Amino-2-[2- (4-hexylphenyl) ethyl]-1,3-propanediol
Sign In for Pricing
View Details 414955-02 50 mg
2-Amino-2-[2- (4-hexylphenyl) ethyl]-1,3-propanediol
Sign In for Pricing
View Details 
GTR15349181 1 Vial
Lentiviral human SLC19A1 shRNA (UAS) - Lentiviral human SLC19A1 shRNA (UAS, iRFP) (25)
Sign In for Pricing
View Details MBS6159288-01 0.1 mL
PATZ1 (POZ-, AT Hook-, and Zinc Finger-containing Protein 1, BTB/POZ Domain Zinc Finger Transcription Factor, Protein Kinase A RI Subunit alpha-associated Protein, Zinc Finger and BTB Domain-containing Protein 19, Zinc Finger Protein 278, Zinc Finger Sarc
Sign In for Pricing
View Details MBS6159288-02 5x 0.1 mL
PATZ1 (POZ-, AT Hook-, and Zinc Finger-containing Protein 1, BTB/POZ Domain Zinc Finger Transcription Factor, Protein Kinase A RI Subunit alpha-associated Protein, Zinc Finger and BTB Domain-containing Protein 19, Zinc Finger Protein 278, Zinc Finger Sarc
Sign In for Pricing
View Details