Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PGK2 Rabbit Polyclonal Antibody (HRP)

PGK2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PGKB, PGKPS, HEL-S-272, dJ417L20.2

UniProt

P07205

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PGK2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ITVIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKILPGVEALSNM

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_620061

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human DCTN1 shRNA (UAS) - Lentiviral human DCTN1 shRNA (UAS) (100)
GTR15103446 1 Vial

Lentiviral human DCTN1 shRNA (UAS) - Lentiviral human DCTN1 shRNA (UAS) (100)

Sign In for Pricing
View Details
Simulated Renal Fluid (BZ270) - 100 mL
BZ270-01 100 mL

Simulated Renal Fluid (BZ270) - 100 mL

Sign In for Pricing
View Details
Simulated Renal Fluid (BZ270) - 100 mL
BZ270-02 200 mL

Simulated Renal Fluid (BZ270) - 100 mL

Sign In for Pricing
View Details
Simulated Renal Fluid (BZ270) - 100 mL
BZ270-03 500 mL

Simulated Renal Fluid (BZ270) - 100 mL

Sign In for Pricing
View Details
Simulated Renal Fluid (BZ270) - 100 mL
BZ270-04 1000 mL

Simulated Renal Fluid (BZ270) - 100 mL

Sign In for Pricing
View Details
GENLISA Fish Epinephrine / Adrenaline (EPI) ELISA
KLF0327 1x 96 Well

GENLISA Fish Epinephrine / Adrenaline (EPI) ELISA

Sign In for Pricing
View Details