Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAOX Rabbit Polyclonal Antibody (Biotin)

PAOX Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PAO

UniProt

Q6QHF9

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PAOX

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LCLTQVLRRVTGNPRLPAPKSVLRSRWHSAPYTRGSYSYVAVGSTGGDLD

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

AAS64381

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human TAS2R3 shRNA (UAS) - Lentiviral human TAS2R3 shRNA (UAS, iRFP) (100)
GTR15312522 1 Vial

Lentiviral human TAS2R3 shRNA (UAS) - Lentiviral human TAS2R3 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
PHIP (WDR11, PH-interacting Protein, IRS-1 PH Domain-binding Protein, WD Repeat-containing Protein 11, FLJ20705, FLJ45918, MGC90216) (HRP)
MBS6154128-01 0.1 mL

PHIP (WDR11, PH-interacting Protein, IRS-1 PH Domain-binding Protein, WD Repeat-containing Protein 11, FLJ20705, FLJ45918, MGC90216) (HRP)

Sign In for Pricing
View Details
PHIP (WDR11, PH-interacting Protein, IRS-1 PH Domain-binding Protein, WD Repeat-containing Protein 11, FLJ20705, FLJ45918, MGC90216) (HRP)
MBS6154128-02 5x 0.1 mL

PHIP (WDR11, PH-interacting Protein, IRS-1 PH Domain-binding Protein, WD Repeat-containing Protein 11, FLJ20705, FLJ45918, MGC90216) (HRP)

Sign In for Pricing
View Details
GNL3L Antibody
A14112-50UG 50 µg

GNL3L Antibody

Sign In for Pricing
View Details
CCDC93 Antibody
orb1319164-01 30 µL

CCDC93 Antibody

Sign In for Pricing
View Details
CCDC93 Antibody
orb1319164-02 50 μL

CCDC93 Antibody

Sign In for Pricing
View Details