Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSG1 Rabbit Polyclonal Antibody (HRP)

GSG1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MGC111023, MGC3146

UniProt

Q2KHT4

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human GSG1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VGPLTSYHQYHNQPIHSVSEGVDFYSELRNKGFQRGASQELKEAVRSSVE

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_722545

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mycobacterium tuberculosis PCR Lyophilized Kits
TM42150L 100 Reactions

Mycobacterium tuberculosis PCR Lyophilized Kits

Sign In for Pricing
View Details
CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/1757), 0.2mg/mL
BNUB1757-100 1x 100 µL

CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/1757), 0.2mg/mL

Sign In for Pricing
View Details
Histone H3 Recombinant Rabbit Monoclonal Antibody [JJ092-08]
ET1701-81 100 µL

Histone H3 Recombinant Rabbit Monoclonal Antibody [JJ092-08]

Sign In for Pricing
View Details
PTPDC1 (NM_152422) Human Over-expression Lysate
LC403467 20 µg

PTPDC1 (NM_152422) Human Over-expression Lysate

Sign In for Pricing
View Details
Oxo Thiamine O-Diphosphate Ammonium Salt
TRC-O864220-1MG 1 mg

Oxo Thiamine O-Diphosphate Ammonium Salt

Sign In for Pricing
View Details
Recombinant EHD3 Antibody
RN-13698-01 50 μL

Recombinant EHD3 Antibody

Sign In for Pricing
View Details