Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GTF2A1L Rabbit Polyclonal Antibody (HRP)

GTF2A1L Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ALF

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human GTF2A1L

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EFLGNIDGGDLKVPEEEADSISNEDSATNSSDNEDPQVNIVEEDPLNSGD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_751946

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C18orf62 CRISPRa sgRNA lentivector (set of three targets)(Human)
14044121 3x 1.0µg DNA

C18orf62 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
EIF2B3 (NM_001166588) Human Over-expression Lysate
LC433030 20 µg

EIF2B3 (NM_001166588) Human Over-expression Lysate

Sign In for Pricing
View Details
ELISA Kit For Elongin-B
E15274h 96 Tests

ELISA Kit For Elongin-B

Sign In for Pricing
View Details
Recombinant Escherichia coli p-hydroxybenzoic acid efflux pump subunit AaeB (aaeB), partial
MBS1098580-01 1 mg (E-Coli)

Recombinant Escherichia coli p-hydroxybenzoic acid efflux pump subunit AaeB (aaeB), partial

Sign In for Pricing
View Details
Recombinant Escherichia coli p-hydroxybenzoic acid efflux pump subunit AaeB (aaeB), partial
MBS1098580-02 1 mg (Yeast)

Recombinant Escherichia coli p-hydroxybenzoic acid efflux pump subunit AaeB (aaeB), partial

Sign In for Pricing
View Details
Rabbit Polyclonal PACRG Antibody
NBP2-55838-25ul 25 µL

Rabbit Polyclonal PACRG Antibody

Sign In for Pricing
View Details