Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GTF2A1L Rabbit Polyclonal Antibody (HRP)

GTF2A1L Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ALF

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human GTF2A1L

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EFLGNIDGGDLKVPEEEADSISNEDSATNSSDNEDPQVNIVEEDPLNSGD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_751946

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BNIP3L Antibody
E30AOC194 100 µL

BNIP3L Antibody

Sign In for Pricing
View Details
PNLIPRP3, NT (PNLIPRP3, Pancreatic lipase-related protein 3) (MaxLight 550) discontinued
040213-ML550 100 µL

PNLIPRP3, NT (PNLIPRP3, Pancreatic lipase-related protein 3) (MaxLight 550) discontinued

Sign In for Pricing
View Details
CRYL1 (NM_015974) Human 3' UTR Clone
SC206451 10 µg

CRYL1 (NM_015974) Human 3' UTR Clone

Sign In for Pricing
View Details
RGD1560436 Protein Lysate (Rat) with C-HA Tag
39220036 100 µg

RGD1560436 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
FRA1 Antibody [H14K9]
C19063-50uL 50 μL

FRA1 Antibody [H14K9]

Sign In for Pricing
View Details
Epidermal cells of Allium cepa (onion), flat mount shows typical plant cells with nuclei, cytoplasm and cell walls
As111c 7.6 x 2.6 cm

Epidermal cells of Allium cepa (onion), flat mount shows typical plant cells with nuclei, cytoplasm and cell walls

Sign In for Pricing
View Details