Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pias2 Rabbit Polyclonal Antibody (HRP)

Pias2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Di, PI, DIP, Dib, Miz, Miz1, PIAS, SIZ2, ARIP3, PIASxb, AI462206, AU018068, PIASxbeta, PIASxalpha, PIASxalpha6

UniProt

Q8C5D8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PAVQIKIRELYRRRYPRTLEGLCDLSTIKSSVFSLDGSSSPVEPDLPVAG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001157639

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SUSD4 activation kit by CRISPRa
GA110484 1 Kit

Human SUSD4 activation kit by CRISPRa

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (C3e/1931), Biotin conjugate, 0.1mg/mL
BNCB1931-500 1x 500 µL

CD3e (T-Cell Marker) (C3e/1931), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSPC150 (UBE2T) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F5]
TA501645AM 100 µL

HSPC150 (UBE2T) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F5]

Sign In for Pricing
View Details
ZNF214 Human Gene Knockout Kit (CRISPR)
KN416619 1 Kit

ZNF214 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD16a, AlpHcAbs® Human
HA710339 100 µg

CD16a, AlpHcAbs® Human

Sign In for Pricing
View Details
KPNB1 Recombinant Rabbit monoclonal Antibody
HA750735 100 µL

KPNB1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details