Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TEX14 Rabbit Polyclonal Antibody (Biotin)

TEX14 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CT113, SPGF23

UniProt

Q8IWB6

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human TEX14

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ASSDTLVAVEKSYSTSSPIEEDFEGIQGAFAQPQVSGEEKFQMRKILGKN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

160kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_112562

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human REG1A sgRNA gene knockout kit - Lentiviral human REG1A sgRNA gene knockout kit (plasmid)
GTR15401639 1 Vial

Lentiviral human REG1A sgRNA gene knockout kit - Lentiviral human REG1A sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Camel Testis-Specific Protein 10-Interacting Protein (TSGA10IP) ELISA Kit
MBS9922711-01 48 Well

Camel Testis-Specific Protein 10-Interacting Protein (TSGA10IP) ELISA Kit

Sign In for Pricing
View Details
Camel Testis-Specific Protein 10-Interacting Protein (TSGA10IP) ELISA Kit
MBS9922711-02 96 Well

Camel Testis-Specific Protein 10-Interacting Protein (TSGA10IP) ELISA Kit

Sign In for Pricing
View Details
Camel Testis-Specific Protein 10-Interacting Protein (TSGA10IP) ELISA Kit
MBS9922711-03 5x 96 Well

Camel Testis-Specific Protein 10-Interacting Protein (TSGA10IP) ELISA Kit

Sign In for Pricing
View Details
Camel Testis-Specific Protein 10-Interacting Protein (TSGA10IP) ELISA Kit
MBS9922711-04 10x 96 Well

Camel Testis-Specific Protein 10-Interacting Protein (TSGA10IP) ELISA Kit

Sign In for Pricing
View Details
GATA4, CT (GATA Binding Protein 4, GATA-binding Factor 4, Transcription Factor GATA-4) (MaxLight 650) discontinued
G2021-51E-ML650 100 µL

GATA4, CT (GATA Binding Protein 4, GATA-binding Factor 4, Transcription Factor GATA-4) (MaxLight 650) discontinued

Sign In for Pricing
View Details