Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATG16L1 Rabbit Polyclonal Antibody (HRP)

ATG16L1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

IBD10, WDR30, APG16L, ATG16A, ATG16L

UniProt

Q676U5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ATG16L1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TSPVRAISRAATKRLSQPAGGLLDSITNIFGRRSVSSFPVPQDNVDTHPG

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

68kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_110430

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CNIH4 activation kit by CRISPRa
GA109230 1 Kit

Human CNIH4 activation kit by CRISPRa

Sign In for Pricing
View Details
Snrk Mouse Gene Knockout Kit (CRISPR)
KN516392 1 Kit

Snrk Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HIPK1 Mouse Monoclonal Antibody [Clone ID: OTI2C11]
CF807260 100 µg

HIPK1 Mouse Monoclonal Antibody [Clone ID: OTI2C11]

Sign In for Pricing
View Details
N-Acetyl-4-benzoquinone Imine
TRC-A170000-5MG 5 mg

N-Acetyl-4-benzoquinone Imine

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Mouse CD80 Antibody[16-10A1]
E-AB-F0992Q-01 50 Tests

Elab Fluor® Violet 450 Anti-Mouse CD80 Antibody[16-10A1]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Mouse CD80 Antibody[16-10A1]
E-AB-F0992Q-02 100 Tests

Elab Fluor® Violet 450 Anti-Mouse CD80 Antibody[16-10A1]

Sign In for Pricing
View Details