Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACADS Rabbit Polyclonal Antibody (Biotin)

ACADS Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SCAD, ACAD3

UniProt

P16219

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ACADS

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ASTGVIMSVNNSLYLGPILKFGSKEQKQAWVTPFTSGDKIGCFALSEPGN

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_000008

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-DPA1, CT (HLA-DPA1, HLA-DP1A, HLASB, HLA class II histocompatibility antigen, DP alpha 1 chain, DP (W3), DP (W4), HLA-SB alpha chain, MHC class II DP3-alpha, MHC class II DPA1) (Biotin) discontinued
036620-Biotin 200 µL

HLA-DPA1, CT (HLA-DPA1, HLA-DP1A, HLASB, HLA class II histocompatibility antigen, DP alpha 1 chain, DP (W3), DP (W4), HLA-SB alpha chain, MHC class II DP3-alpha, MHC class II DPA1) (Biotin) discontinued

Sign In for Pricing
View Details
Recombinant Human PCOLCE Protein, N-His
orb3061032-01 50 µg

Recombinant Human PCOLCE Protein, N-His

Sign In for Pricing
View Details
Recombinant Human PCOLCE Protein, N-His
orb3061032-02 100 µg

Recombinant Human PCOLCE Protein, N-His

Sign In for Pricing
View Details
Recombinant Human PCOLCE Protein, N-His
orb3061032-03 1 mg

Recombinant Human PCOLCE Protein, N-His

Sign In for Pricing
View Details
Canine Conserved oligomeric Golgi complex subunit 6 (COG6) ELISA Kit
MBS7225989-01 48 Well

Canine Conserved oligomeric Golgi complex subunit 6 (COG6) ELISA Kit

Sign In for Pricing
View Details
Canine Conserved oligomeric Golgi complex subunit 6 (COG6) ELISA Kit
MBS7225989-02 96 Well

Canine Conserved oligomeric Golgi complex subunit 6 (COG6) ELISA Kit

Sign In for Pricing
View Details