GPX4, Human (U73C, HEK293, Flag)
GPX4 Protein, Human (U73C, HEK293, Flag) is the recombinant human-derived GPX4 protein, expressed by HEK293, with N-Flag tag.
Product Specifications
Product Name Alternative
GPX4 Protein, Human (U73C, HEK293, Flag), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/gpx4-protein-human-hek293-flag.html
Purity
90.00
Smiles
CASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF
Molecular Formula
2879 (Gene_ID) P36969-1 (C29-F197, U73C) (Accession)
Molecular Weight
Approximately 21 kDa
Shipping Conditions
Dry ice
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740158-500 1x 500 µL
Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880525-100 1x 100 µL
CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940977-100 1x 100 µL
TGF-beta (1D11.16.8), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040391-500 1x 500 µL
CD81 / TAPA-1 (1.3.3.22), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680043-100 1x 100 µL
P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400676-500 1x 500 µL
MUC18 / Mucin 18 / CD146 (OJ79c), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details