Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GLA Rabbit Polyclonal Antibody (HRP)

GLA Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GALA

UniProt

P06280

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GLA

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFGYYDIDAQTF

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_000160

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human PRRG3 shRNA (UAS) - Lentiviral human PRRG3 shRNA (UAS, GFP) (25)
GTR15111728 1 Vial

Lentiviral human PRRG3 shRNA (UAS) - Lentiviral human PRRG3 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Prostate Specific Antigen (PSA, Kallikrein-3, Kallikrein III, Seminin, Semenogelase, gamma-Seminoprotein, P-30 antigen, KLK3) (FITC)
MBS6128315-01 0.1 mL

Prostate Specific Antigen (PSA, Kallikrein-3, Kallikrein III, Seminin, Semenogelase, gamma-Seminoprotein, P-30 antigen, KLK3) (FITC)

Sign In for Pricing
View Details
Prostate Specific Antigen (PSA, Kallikrein-3, Kallikrein III, Seminin, Semenogelase, gamma-Seminoprotein, P-30 antigen, KLK3) (FITC)
MBS6128315-02 5x 0.1 mL

Prostate Specific Antigen (PSA, Kallikrein-3, Kallikrein III, Seminin, Semenogelase, gamma-Seminoprotein, P-30 antigen, KLK3) (FITC)

Sign In for Pricing
View Details
CD8a Protein Vector (Human) (pPM-C-HA)
15576021 500 ng

CD8a Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Human enkephalin, ENK ELISA KIT
EA0043Hu-01 96 Well

Human enkephalin, ENK ELISA KIT

Sign In for Pricing
View Details
Rnf152 3'UTR Luciferase Stable Cell Line
TU219525 1.0 mL

Rnf152 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details