Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIG1 Rabbit Polyclonal Antibody (Biotin)

LIG1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

P18858

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human LIG1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDASEIQVQVCLYAF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

102kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_000225

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

AP1S3, NT (AP1S3, AP-1 complex subunit sigma-3, Adapter-related protein complex 1 sigma-1C subunit, Adaptor protein complex AP-1 sigma-1C subunit, Clathrin assembly protein complex 1 sigma-1C small chain, Golgi adaptor HA1/AP1 adaptin sigma-1C subunit, Sigma 1C subunit of AP-1 clathrin, Sigma-adaptin 1C, Sigma1C-adaptin) (MaxLight 650) discontinued
031940-ML650 100 µL

AP1S3, NT (AP1S3, AP-1 complex subunit sigma-3, Adapter-related protein complex 1 sigma-1C subunit, Adaptor protein complex AP-1 sigma-1C subunit, Clathrin assembly protein complex 1 sigma-1C small chain, Golgi adaptor HA1/AP1 adaptin sigma-1C subunit, Sigma 1C subunit of AP-1 clathrin, Sigma-adaptin 1C, Sigma1C-adaptin) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Mouse WD repeat-containing protein 64 (WDR64) ELISA Kit
abx553464 96 Tests

Mouse WD repeat-containing protein 64 (WDR64) ELISA Kit

Sign In for Pricing
View Details
Recombinant Mouse CDKN2A/p16INK4a Protein, N-His
AP97888 50 µg

Recombinant Mouse CDKN2A/p16INK4a Protein, N-His

Sign In for Pricing
View Details
VPR-66 ROR gamma T and ROR alpha Inhibitor (ROR gamma T and ROR alpha Inhibitor)
NBP2-29335-10mg 10 mg

VPR-66 ROR gamma T and ROR alpha Inhibitor (ROR gamma T and ROR alpha Inhibitor)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Enolase, Neuron Specific (NSE)
MBS2147903-01 0.1 mL

APC-Linked Monoclonal Antibody to Enolase, Neuron Specific (NSE)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Enolase, Neuron Specific (NSE)
MBS2147903-02 0.2 mL

APC-Linked Monoclonal Antibody to Enolase, Neuron Specific (NSE)

Sign In for Pricing
View Details