Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMH Rabbit Polyclonal Antibody (HRP)

AMH Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MIF, MIS

UniProt

Q6GTN3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human AMH

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQARG

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Sheep

Tested Applications

IHC, WB

NCBI Accession Number

NP_000470

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLTF Polyclonal Antibody, Cy7 Conjugated
bs-6107R-Cy7 100 µL

HLTF Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
Western Ice-free Rapid Transfer Buffer (10x)
EZWB07-10L-10x 500 mL

Western Ice-free Rapid Transfer Buffer (10x)

Sign In for Pricing
View Details
CTSK, ID (E112) (CTSK, CTSO, CTSO2, Cathepsin K, Cathepsin O, Cathepsin O2, Cathepsin X) (HRP) discontinued
034349-HRP 200 µL

CTSK, ID (E112) (CTSK, CTSO, CTSO2, Cathepsin K, Cathepsin O, Cathepsin O2, Cathepsin X) (HRP) discontinued

Sign In for Pricing
View Details
Myosin XVIIIa (H-10) : m-IgGκ BP-HRP Bundle
sc-522208 1 Kit

Myosin XVIIIa (H-10) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details
RNF217 (C6orf172, IBRDC1, Probable E3 Ubiquitin-protein Ligase RNF217, IBR Domain-containing Protein 1, RING Finger Protein 217, MGC26996, DJ84N20.1) (PE)
MBS6158304-01 0.1 mL

RNF217 (C6orf172, IBRDC1, Probable E3 Ubiquitin-protein Ligase RNF217, IBR Domain-containing Protein 1, RING Finger Protein 217, MGC26996, DJ84N20.1) (PE)

Sign In for Pricing
View Details
RNF217 (C6orf172, IBRDC1, Probable E3 Ubiquitin-protein Ligase RNF217, IBR Domain-containing Protein 1, RING Finger Protein 217, MGC26996, DJ84N20.1) (PE)
MBS6158304-02 5x 0.1 mL

RNF217 (C6orf172, IBRDC1, Probable E3 Ubiquitin-protein Ligase RNF217, IBR Domain-containing Protein 1, RING Finger Protein 217, MGC26996, DJ84N20.1) (PE)

Sign In for Pricing
View Details