Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOA4 Rabbit Polyclonal Antibody (HRP)

APOA4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MGC142154, MGC142156

UniProt

P06727

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human APOA4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKEKESQDKTLSLPELEQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_000473

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PPP1R26 qPCR Primer Pair
QH29821S 200 Tests

Human PPP1R26 qPCR Primer Pair

Sign In for Pricing
View Details
Recombinant Aspergillus oryzae Long chronological lifespan protein 2 (lcl2)
MBS1334818-01 0.02 mg (E-Coli)

Recombinant Aspergillus oryzae Long chronological lifespan protein 2 (lcl2)

Sign In for Pricing
View Details
Recombinant Aspergillus oryzae Long chronological lifespan protein 2 (lcl2)
MBS1334818-02 0.1 mg (E-Coli)

Recombinant Aspergillus oryzae Long chronological lifespan protein 2 (lcl2)

Sign In for Pricing
View Details
Recombinant Aspergillus oryzae Long chronological lifespan protein 2 (lcl2)
MBS1334818-03 0.02 mg (Yeast)

Recombinant Aspergillus oryzae Long chronological lifespan protein 2 (lcl2)

Sign In for Pricing
View Details
Recombinant Aspergillus oryzae Long chronological lifespan protein 2 (lcl2)
MBS1334818-04 0.1 mg (Yeast)

Recombinant Aspergillus oryzae Long chronological lifespan protein 2 (lcl2)

Sign In for Pricing
View Details
Recombinant Aspergillus oryzae Long chronological lifespan protein 2 (lcl2)
MBS1334818-05 0.02 mg (Baculovirus)

Recombinant Aspergillus oryzae Long chronological lifespan protein 2 (lcl2)

Sign In for Pricing
View Details