Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOC2 Rabbit Polyclonal Antibody (HRP)

APOC2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

APO-CII, APOC-II

UniProt

P02655

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human APOC2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLK

Field of Research

Metabolism Research

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

11kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_000474

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBN2 Antibody
CSB-PA025506GA01HU 100 µL

UBN2 Antibody

Sign In for Pricing
View Details
Canine cyclophilin A (CyPA) ELISA Kit
YP-W76101-01 48 Tests

Canine cyclophilin A (CyPA) ELISA Kit

Sign In for Pricing
View Details
Canine cyclophilin A (CyPA) ELISA Kit
YP-W76101-02 96 Tests

Canine cyclophilin A (CyPA) ELISA Kit

Sign In for Pricing
View Details
CD11C (Integrin alpha-X, CD11 antigen-like Family Member C, Leu M5, Leukocyte Adhesion Glycoprotein p150, 95 alpha Chain, Leukocyte Adhesion Receptor p150, 95, ITGAX) discontinued
359952-01 50 µL

CD11C (Integrin alpha-X, CD11 antigen-like Family Member C, Leu M5, Leukocyte Adhesion Glycoprotein p150, 95 alpha Chain, Leukocyte Adhesion Receptor p150, 95, ITGAX) discontinued

Sign In for Pricing
View Details
CD11C (Integrin alpha-X, CD11 antigen-like Family Member C, Leu M5, Leukocyte Adhesion Glycoprotein p150, 95 alpha Chain, Leukocyte Adhesion Receptor p150, 95, ITGAX) discontinued
359952-02 100 µL

CD11C (Integrin alpha-X, CD11 antigen-like Family Member C, Leu M5, Leukocyte Adhesion Glycoprotein p150, 95 alpha Chain, Leukocyte Adhesion Receptor p150, 95, ITGAX) discontinued

Sign In for Pricing
View Details
METTL11A (NTMT1) (NM_014064) Human Recombinant Protein
PROTQ9BV86 20 µg

METTL11A (NTMT1) (NM_014064) Human Recombinant Protein

Sign In for Pricing
View Details