Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hbe1 Rabbit Polyclonal Antibody (FITC)

Hbe1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Glnb1, Hbb-y

UniProt

O88752

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Hbe1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MVNFTAEEKSLINGLWSKVNVEEVGGEALGRLLVVYPWTQRFFDSFGNLS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

16kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_001008890

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DiagPoly™ Plain Polystyrene Particles, 200 µm
DMP-L079 0.5 g

DiagPoly™ Plain Polystyrene Particles, 200 µm

Sign In for Pricing
View Details
Anti-Mouse CD152/CTLA4 Antibody (9D9), PE
FMD17222 100 Tests

Anti-Mouse CD152/CTLA4 Antibody (9D9), PE

Sign In for Pricing
View Details
JE (MCP-1), murine recombinant
4207-1000 1 mg

JE (MCP-1), murine recombinant

Sign In for Pricing
View Details
HSD3B1 (3 beta-hydroxysteroid Dehydrogenase/Delta 5->4-isomerase Type 1, 3 beta-hydroxysteroid Dehydrogenase/Delta 5->4-isomerase Type I, 3-beta-HSD I, Trophoblast Antigen FDO161G, 3BH, HSDB3A) (AP) discontinued
128104-AP 100 µL

HSD3B1 (3 beta-hydroxysteroid Dehydrogenase/Delta 5->4-isomerase Type 1, 3 beta-hydroxysteroid Dehydrogenase/Delta 5->4-isomerase Type I, 3-beta-HSD I, Trophoblast Antigen FDO161G, 3BH, HSDB3A) (AP) discontinued

Sign In for Pricing
View Details
Mouse Phosphatidylinositol antibody IgM ELISA Kit
MBS746077-01 48 Well

Mouse Phosphatidylinositol antibody IgM ELISA Kit

Sign In for Pricing
View Details
Mouse Phosphatidylinositol antibody IgM ELISA Kit
MBS746077-02 96 Well

Mouse Phosphatidylinositol antibody IgM ELISA Kit

Sign In for Pricing
View Details