Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hbe1 Rabbit Polyclonal Antibody (HRP)

Hbe1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Glnb1, Hbb-y

UniProt

O88752

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Hbe1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MVNFTAEEKSLINGLWSKVNVEEVGGEALGRLLVVYPWTQRFFDSFGNLS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

16kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_001008890

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Cysteine and histidine rich protein 1 (CYHR1) ELISA Kit
GTR10366959 96 Well

Goat Cysteine and histidine rich protein 1 (CYHR1) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to SIRT3
MBS8528392-01 0.1 mL

Mouse Monoclonal Antibody to SIRT3

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to SIRT3
MBS8528392-02 0.1 mL (AF405L)

Mouse Monoclonal Antibody to SIRT3

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to SIRT3
MBS8528392-03 0.1 mL (AF405S)

Mouse Monoclonal Antibody to SIRT3

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to SIRT3
MBS8528392-04 0.1 mL (AF610)

Mouse Monoclonal Antibody to SIRT3

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to SIRT3
MBS8528392-05 0.1 mL (AF635)

Mouse Monoclonal Antibody to SIRT3

Sign In for Pricing
View Details