Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL1A Rabbit Polyclonal Antibody (HRP)

IL1A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

IL1, IL-1A, IL1F1, IL1-ALPHA, IL-1 alpha

UniProt

P01583

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human IL1A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VPDMFEDLKNCYSENEEDSSSIDHLSLNQKSFYHVSYGPLHEGCMDQSVS

Field of Research

Immunology & Inflammation

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Goat, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_000566

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fmoc-Gln(Trt)-Wang resin (100-200 mesh, 0.50-0.90 mmol/g)
D-2325.0001 1.0g

Fmoc-Gln(Trt)-Wang resin (100-200 mesh, 0.50-0.90 mmol/g)

Sign In for Pricing
View Details
L-Luciferin free acid
JBA50031-01 250 mg

L-Luciferin free acid

Sign In for Pricing
View Details
L-Luciferin free acid
JBA50031-02 500 mg

L-Luciferin free acid

Sign In for Pricing
View Details
MutS Antibody
orb863124 2 mg

MutS Antibody

Sign In for Pricing
View Details
CD221 (Insulin-like growth factor I Receptor, IGF-I Receptor) (FITC)
C2548-97A-FITC 100 µL

CD221 (Insulin-like growth factor I Receptor, IGF-I Receptor) (FITC)

Sign In for Pricing
View Details
Casp7 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3726203 1.0 µg DNA

Casp7 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details