Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL1A Rabbit Polyclonal Antibody (HRP)

IL1A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

IL1, IL-1A, IL1F1, IL1-ALPHA, IL-1 alpha

UniProt

P01583

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human IL1A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VSYGPLHEGCMDQSVSLSISETSKTSKLTFKESMVVVATNGKVLKKRRLS

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Human, Mouse, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_000566

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBCE Protein Vector (Mouse) (pPM-C-HA)
46279024 500 ng

TBCE Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Angiotensin Converting Enzyme 1/ACE Rabbit Polyclonal Antibody (Fluoro594)
orb3080167 100 µg

Angiotensin Converting Enzyme 1/ACE Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
RSPH6A (NM_030785) Human Recombinant Protein
TP315886M 100 µg

RSPH6A (NM_030785) Human Recombinant Protein

Sign In for Pricing
View Details
Peroxisome Proliferator Activated Receptor Gamma (PPARg, PPAR-G, PPARG1, PPARG2, NR1C3, Glitazone Receptor, Nuclear Receptor Subfamily 1 Group C Member 3)
141838 200 µL

Peroxisome Proliferator Activated Receptor Gamma (PPARg, PPAR-G, PPARG1, PPARG2, NR1C3, Glitazone Receptor, Nuclear Receptor Subfamily 1 Group C Member 3)

Sign In for Pricing
View Details
MTL5 (C-Term) Rabbit pAb
MBS8553099-01 0.1 mL

MTL5 (C-Term) Rabbit pAb

Sign In for Pricing
View Details
MTL5 (C-Term) Rabbit pAb
MBS8553099-02 0.1 mL (AF405L)

MTL5 (C-Term) Rabbit pAb

Sign In for Pricing
View Details