Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL1A Rabbit Polyclonal Antibody (HRP)

IL1A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

IL1, IL-1A, IL1F1, IL1-ALPHA, IL-1 alpha

UniProt

P01583

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human IL1A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VSYGPLHEGCMDQSVSLSISETSKTSKLTFKESMVVVATNGKVLKKRRLS

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Human, Mouse, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_000566

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human KYNU Protein, N-His
YHH35701 100 μg

Recombinant Human KYNU Protein, N-His

Sign In for Pricing
View Details
RD3 (NM_183059) Human Tagged ORF Clone Lentiviral Particle
RC209596L2V 200 µL

RD3 (NM_183059) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Lentiviral human TMED2 shRNA (UAS) - Lentiviral human TMED2 shRNA (UAS, RFP) (25)
GTR15092171 1 Vial

Lentiviral human TMED2 shRNA (UAS) - Lentiviral human TMED2 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
RNY4P2 siRNA Oligos set (Human)
40639171 3x 5 nmol

RNY4P2 siRNA Oligos set (Human)

Sign In for Pricing
View Details
GRK2 Antibody (HRP)
orb240222-01 50 µg

GRK2 Antibody (HRP)

Sign In for Pricing
View Details
GRK2 Antibody (HRP)
orb240222-02 100 µg

GRK2 Antibody (HRP)

Sign In for Pricing
View Details