Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Igfbp5 Rabbit Polyclonal Antibody (Biotin)

Igfbp5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

IGFBP, IGFBP-5, AI256729, AW208790, IGFBP-5P

UniProt

Q3UQV0

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IERDSREHEEPTTSEMAEETYSPKVFRPKHTRISELKAEAVKKDRRKKLT

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_034648

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

STRN4 Conjugated Antibody
MBS9453635-01 0.1 mL (AF350)

STRN4 Conjugated Antibody

Sign In for Pricing
View Details
STRN4 Conjugated Antibody
MBS9453635-02 0.1 mL (AF405)

STRN4 Conjugated Antibody

Sign In for Pricing
View Details
STRN4 Conjugated Antibody
MBS9453635-03 0.1 mL (AF488)

STRN4 Conjugated Antibody

Sign In for Pricing
View Details
STRN4 Conjugated Antibody
MBS9453635-04 0.1 mL (AF555)

STRN4 Conjugated Antibody

Sign In for Pricing
View Details
STRN4 Conjugated Antibody
MBS9453635-05 0.1 mL (Biotin)

STRN4 Conjugated Antibody

Sign In for Pricing
View Details
CLEANING PAD, 4mm Bristles, for Pin Tip Cleaning in VP 540S Scrubbing Wash Reservoir
VP 426 1 EACH

CLEANING PAD, 4mm Bristles, for Pin Tip Cleaning in VP 540S Scrubbing Wash Reservoir

Sign In for Pricing
View Details