Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Igfbp5 Rabbit Polyclonal Antibody (HRP)

Igfbp5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

IGFBP, IGFBP-5, AI256729, AW208790, IGFBP-5P

UniProt

Q3UQV0

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IERDSREHEEPTTSEMAEETYSPKVFRPKHTRISELKAEAVKKDRRKKLT

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_034648

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal RELM beta Antibody [mFluor Violet 450 SE]
NB200-204MFV450 0.1 mL

Rabbit Polyclonal RELM beta Antibody [mFluor Violet 450 SE]

Sign In for Pricing
View Details
GPR50, ID (GPR50, Melatonin-related receptor, G protein-coupled receptor 50, H9) (PE) discontinued
036245-PE 200 µL

GPR50, ID (GPR50, Melatonin-related receptor, G protein-coupled receptor 50, H9) (PE) discontinued

Sign In for Pricing
View Details
Rat Epithelial Neutrophil Activating Peptide 78, Ena-78 Elisa Kit
EKC42252 96 Tests

Rat Epithelial Neutrophil Activating Peptide 78, Ena-78 Elisa Kit

Sign In for Pricing
View Details
Plac8 (NM_001108353) Rat Tagged Lenti ORF Clone
RR212192L4 10 µg

Plac8 (NM_001108353) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Purified anti-BTK Phospho (Tyr551)/ITK Phospho (Tyr512)
GT19098 100 µg

Purified anti-BTK Phospho (Tyr551)/ITK Phospho (Tyr512)

Sign In for Pricing
View Details
CNN1 Recombinant Rabbit mAb, AP conjugated
orb2837622 100 µL

CNN1 Recombinant Rabbit mAb, AP conjugated

Sign In for Pricing
View Details