Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL6 Rabbit Polyclonal Antibody (Biotin)

IL6 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CDF, HGF, HSF, BSF2, IL-6, BSF-2, IFNB2, IFN-beta-2

UniProt

P05231

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human IL6

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVL

Field of Research

Immunology & Inflammation

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

23 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

NCBI Accession Number

NP_000591

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cdca2 3'UTR GFP Stable Cell Line
TU153578 1.0 mL

Cdca2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
DHDH Rabbit Polyclonal Antibody
orb258036 100 µg

DHDH Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CAB39 Polyclonal Antibody, Biotin Conjugated
bs-3636R-Biotin 100 µL

CAB39 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
4930404A10Rik siRNA Oligos set (Mouse)
10599174 3x 5 nmol

4930404A10Rik siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Human C17orf47 knockdown cell line
ABC-KD1799 1 Vial

Human C17orf47 knockdown cell line

Sign In for Pricing
View Details
Serine/threonine kinase 11, LKB1 Control Peptide discontinued
S7973-58W5 50 µg

Serine/threonine kinase 11, LKB1 Control Peptide discontinued

Sign In for Pricing
View Details