Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL6 Rabbit Polyclonal Antibody (FITC)

IL6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CDF, HGF, HSF, BSF2, IL-6, BSF-2, IFNB2, IFN-beta-2

UniProt

P05231

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human IL6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: CFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVL

Field of Research

Immunology & Inflammation

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

23 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

NCBI Accession Number

NP_000591

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF8 Rabbit Polyclonal Antibody (BF647)
orb2378712 100 µL

RNF8 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
SAG101 Antibody
orb797033 2 mg

SAG101 Antibody

Sign In for Pricing
View Details
TFEB (Transcription Factor EB, AlphaTFEB, TCFEB, bHLHe35) (MaxLight 550)
MBS6219634-01 0.1 mL

TFEB (Transcription Factor EB, AlphaTFEB, TCFEB, bHLHe35) (MaxLight 550)

Sign In for Pricing
View Details
TFEB (Transcription Factor EB, AlphaTFEB, TCFEB, bHLHe35) (MaxLight 550)
MBS6219634-02 5x 0.1 mL

TFEB (Transcription Factor EB, AlphaTFEB, TCFEB, bHLHe35) (MaxLight 550)

Sign In for Pricing
View Details
Lentiviral human GLDC shRNA (UAS) - Lentiviral human GLDC shRNA (UAS, GFP) (25)
GTR15122132 1 Vial

Lentiviral human GLDC shRNA (UAS) - Lentiviral human GLDC shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
1- (4-Chloro-2-fluorophenyl) ethan-1-amine hydrochloride
GND60800-01 50 mg

1- (4-Chloro-2-fluorophenyl) ethan-1-amine hydrochloride

Sign In for Pricing
View Details