Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL6 Rabbit Polyclonal Antibody (HRP)

IL6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CDF, HGF, HSF, BSF2, IL-6, BSF-2, IFNB2, IFN-beta-2

UniProt

P05231

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human IL6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVL

Field of Research

Immunology & Inflammation

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

23 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

NCBI Accession Number

NP_000591

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSHR/LGR3 Mouse Monoclonal Antibody
orb2974494-01 50 µg

TSHR/LGR3 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
TSHR/LGR3 Mouse Monoclonal Antibody
orb2974494-02 100 µg

TSHR/LGR3 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
PLLP Protein Vector (Human) (pPB-N-His)
PV031758 500 ng

PLLP Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
ZNF763, CT (ZNF763, Zinc finger protein 763) (Biotin)
MBS6367660-01 0.2 mL

ZNF763, CT (ZNF763, Zinc finger protein 763) (Biotin)

Sign In for Pricing
View Details
ZNF763, CT (ZNF763, Zinc finger protein 763) (Biotin)
MBS6367660-02 5x 0.2 mL

ZNF763, CT (ZNF763, Zinc finger protein 763) (Biotin)

Sign In for Pricing
View Details
APBB1IP Antibody
orb682623 100 µL

APBB1IP Antibody

Sign In for Pricing
View Details