Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGF2 Rabbit Polyclonal Antibody (HRP)

IGF2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GRDF, SRS3, IGF-II, PP9974, C11orf43

UniProt

C9JAF2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YDTWKQSTQRLRRGLPALLRARRGHVLAKELEAFREAKRHRPLIALPTQD

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Human, Mouse, Porcine, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_001121070

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AUTS2 siRNA (Human)
CRH8683-01 15 nmol

AUTS2 siRNA (Human)

Sign In for Pricing
View Details
AUTS2 siRNA (Human)
CRH8683-02 30 nmol

AUTS2 siRNA (Human)

Sign In for Pricing
View Details
Recombinant Bovine Membrane protein FAM159B (FAM159B)
MBS7014534-01 0.02 mg

Recombinant Bovine Membrane protein FAM159B (FAM159B)

Sign In for Pricing
View Details
Recombinant Bovine Membrane protein FAM159B (FAM159B)
MBS7014534-02 0.1 mg

Recombinant Bovine Membrane protein FAM159B (FAM159B)

Sign In for Pricing
View Details
Recombinant Bovine Membrane protein FAM159B (FAM159B)
MBS7014534-03 5x 0.1 mg

Recombinant Bovine Membrane protein FAM159B (FAM159B)

Sign In for Pricing
View Details
Recombinant Equine infectious anemia virus Gag polyprotein (gag)
MBS1097054-01 0.02 mg (E-Coli)

Recombinant Equine infectious anemia virus Gag polyprotein (gag)

Sign In for Pricing
View Details