Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Guk1 Rabbit Polyclonal Antibody (Biotin)

Guk1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

E9PTV0

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RPVVLSGPSGAGKSTLLKKLFQEHGSVFGFSVSHTTRNPRPGEEDGKDYY

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001013133

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bordetella Avium dsbC Protein (aa 20-277)
VAng-Lsx2567-1mgEcoli 1 mg (E. coli)

Recombinant Bordetella Avium dsbC Protein (aa 20-277)

Sign In for Pricing
View Details
WDR49 Protein Vector (Human) (pPB-C-His)
PV046221 500 ng

WDR49 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
NQO1 (NADH Dehydrogenase, Quinone 1, DHQU, DIA4, DTD, NMOR1, NMORI, QR1, Azoreductase, DT-diaphorase, Menadione reductase, Phylloquinone reductase, Quinone reductase 1, NAD (P) H:quinone oxidoreductase 1)
364414 200 µL

NQO1 (NADH Dehydrogenase, Quinone 1, DHQU, DIA4, DTD, NMOR1, NMORI, QR1, Azoreductase, DT-diaphorase, Menadione reductase, Phylloquinone reductase, Quinone reductase 1, NAD (P) H:quinone oxidoreductase 1)

Sign In for Pricing
View Details
MBD1 Monoclonal Antibody, APC-Cy5.5 Conjugated
bsm-63074R-APC-Cy5.5 100 µL

MBD1 Monoclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
GENLISA Goat Casein Alpha S1 (CSN1S1) ELISA
KLG0192 1x 96 Well

GENLISA Goat Casein Alpha S1 (CSN1S1) ELISA

Sign In for Pricing
View Details
WRB (G-1)
sc-393597 200 µg/mL

WRB (G-1)

Sign In for Pricing
View Details