Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LTA4H Rabbit Polyclonal Antibody (HRP)

LTA4H Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

P09960

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human LTA4H

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NACIALSQRWITAKEDDLNSFNATDLKDLSSHQLNEFLAQTLQRAPLPLG

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

69kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_000886

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Gmppa shRNA (UAS) - Lentiviral mouse Gmppa shRNA (UAS, iRFP) plasmid
GTR15257032 1 Vial

Lentiviral mouse Gmppa shRNA (UAS) - Lentiviral mouse Gmppa shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Rabbit anti-human dynactin 6 polyclonal Antibody
MBS716710-01 0.1 mL

Rabbit anti-human dynactin 6 polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human dynactin 6 polyclonal Antibody
MBS716710-02 5x 0.1 mL

Rabbit anti-human dynactin 6 polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Vmn1r202 shRNA (UAS) - Lentiviral mouse Vmn1r202 shRNA (UAS, iRFP) plasmid
GTR15155344 1 Vial

Lentiviral mouse Vmn1r202 shRNA (UAS) - Lentiviral mouse Vmn1r202 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Protein Kinase Type II, cAMP-Dependent Regulatory Subunit (MaxLight 750) discontinued
P9105-51-ML750 100 µL

Protein Kinase Type II, cAMP-Dependent Regulatory Subunit (MaxLight 750) discontinued

Sign In for Pricing
View Details
FSTL1 polyclonal antibody
orb1720385-01 50 µL

FSTL1 polyclonal antibody

Sign In for Pricing
View Details