Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NKIRAS2 Rabbit Polyclonal Antibody (FITC)

NKIRAS2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

KBRAS2, kappaB-Ras2

UniProt

Q9NYR9

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human NKIRAS2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VKLWEVSVADRRSLLEPFVYLASKMTQPQSKSAFPLSRKNKGSGSLDG

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001001349

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nup88 sgRNA CRISPR Lentivector set (Mouse)
K4592701 3x 1.0 µg

Nup88 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
PPFIBP1 (BC001560) Human Untagged Clone
SC311728 10 µg

PPFIBP1 (BC001560) Human Untagged Clone

Sign In for Pricing
View Details
STH CRISPRa sgRNA lentivector (set of three targets)(Human)
45722121 3x 1.0µg DNA

STH CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Sheep Transforming Growth factor beta1, TGF-beta1 ELISA Kit
MBS1602080-01 48 Well

Sheep Transforming Growth factor beta1, TGF-beta1 ELISA Kit

Sign In for Pricing
View Details
Sheep Transforming Growth factor beta1, TGF-beta1 ELISA Kit
MBS1602080-02 96 Well

Sheep Transforming Growth factor beta1, TGF-beta1 ELISA Kit

Sign In for Pricing
View Details
Sheep Transforming Growth factor beta1, TGF-beta1 ELISA Kit
MBS1602080-03 5x 96 Well

Sheep Transforming Growth factor beta1, TGF-beta1 ELISA Kit

Sign In for Pricing
View Details