Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NKIRAS2 Rabbit Polyclonal Antibody (HRP)

NKIRAS2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KBRAS2, kappaB-Ras2

UniProt

Q9NYR9

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human NKIRAS2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VKLWEVSVADRRSLLEPFVYLASKMTQPQSKSAFPLSRKNKGSGSLDG

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001001349

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PACSIN3 (NM_001184975) Human Tagged ORF Clone
RG230058 10 µg

PACSIN3 (NM_001184975) Human Tagged ORF Clone

Sign In for Pricing
View Details
Alpha 1 acid glycoprotein 2 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-9915R-BF647 100 µL

Alpha 1 acid glycoprotein 2 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
ASC1/TRIP4 Rabbit Polyclonal Antibody (Fluoro488)
orb3099711 100 µg

ASC1/TRIP4 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
Human Alpha-1-Antichymotrypsin (a1ACT) ELISA Kit
orb2667245-01 48 Tests

Human Alpha-1-Antichymotrypsin (a1ACT) ELISA Kit

Sign In for Pricing
View Details
Human Alpha-1-Antichymotrypsin (a1ACT) ELISA Kit
orb2667245-02 96 Tests

Human Alpha-1-Antichymotrypsin (a1ACT) ELISA Kit

Sign In for Pricing
View Details
Anti-GDNF Receptor alpha 1/GFRA1 Antibody Picoband® Fluoro647 Conjugated
PB9202-Fluoro647 100 µg/Vial

Anti-GDNF Receptor alpha 1/GFRA1 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details