Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C7orf61 Rabbit Polyclonal Antibody (FITC)

C7orf61 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q8IZ16

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SSQVRTQSPLKTPEAELLWEVYLVLWAVRKHLRRLYRRQERHRRHHVRCH

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_001004323

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RuvA (12C6) HRP
sc-53435 HRP 200 µg/mL

RuvA (12C6) HRP

Sign In for Pricing
View Details
ZFP64 Peptide - C-terminal region (AAP73230)
AAP73230-100UG 100 µg

ZFP64 Peptide - C-terminal region (AAP73230)

Sign In for Pricing
View Details
Atg3 (Autophagy-related Protein 3, APG3, ATG3 Autophagy Related 3 Homolog (S. cerevisiae), APG3-like, AUT1, Protein PC3-96)
MBS618761-01 0.1 mL

Atg3 (Autophagy-related Protein 3, APG3, ATG3 Autophagy Related 3 Homolog (S. cerevisiae), APG3-like, AUT1, Protein PC3-96)

Sign In for Pricing
View Details
Atg3 (Autophagy-related Protein 3, APG3, ATG3 Autophagy Related 3 Homolog (S. cerevisiae), APG3-like, AUT1, Protein PC3-96)
MBS618761-02 5x 0.1 mL

Atg3 (Autophagy-related Protein 3, APG3, ATG3 Autophagy Related 3 Homolog (S. cerevisiae), APG3-like, AUT1, Protein PC3-96)

Sign In for Pricing
View Details
Hyou1 (NM_138867) Rat Untagged Clone
RN200176 10 µg

Hyou1 (NM_138867) Rat Untagged Clone

Sign In for Pricing
View Details
Frozen Tissue Sections, Cartilage
CS523275 5x 5 µm

Frozen Tissue Sections, Cartilage

Sign In for Pricing
View Details