Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C7orf61 Rabbit Polyclonal Antibody (HRP)

C7orf61 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q8IZ16

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SSQVRTQSPLKTPEAELLWEVYLVLWAVRKHLRRLYRRQERHRRHHVRCH

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_001004323

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Amoxicillin / Clavulanic acid 30 µg
7002 5x 50 Discs

Amoxicillin / Clavulanic acid 30 µg

Sign In for Pricing
View Details
PRKD1 Human Pre-designed siRNA Set A
HY-RS11144 1 Set

PRKD1 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
SIGLEC10 293 Cell Lysate
405050 0.1 mg

SIGLEC10 293 Cell Lysate

Sign In for Pricing
View Details
Zebrafish AXIN2 Rabbit Polyclonal Antibody (Fluoro550)
orb3090603 100 µg

Zebrafish AXIN2 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
Rat Tmem44 Pre-designed siRNA Set B
SI214842B 1 Each

Rat Tmem44 Pre-designed siRNA Set B

Sign In for Pricing
View Details
PPEF1 (NM_006240) Human Over-expression Lysate
LC401877 20 µg

PPEF1 (NM_006240) Human Over-expression Lysate

Sign In for Pricing
View Details